SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011598 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011598
Domain Number 1 Region: 342-403
Classification Level Classification E-value
Superfamily ApaG-like 6.02e-17
Family ApaG-like 0.0026
Further Details:      
 
Domain Number 2 Region: 99-246
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000458
Family SMI1/KNR4-like 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000011598
Domain Number - Region: 4-34
Classification Level Classification E-value
Superfamily F-box domain 0.000262
Family F-box domain 0.01
Further Details:      
 
Domain Number - Region: 410-451
Classification Level Classification E-value
Superfamily ARM repeat 0.0374
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011598   Gene: ENSMICG00000012713   Transcript: ENSMICT00000012735
Sequence length 466
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1122:381387:425017:-1 gene:ENSMICG00000012713 transcript:ENSMICT00000012735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMETESTPLTLGSLPTDPLLLILSFLDYRDLIXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKE
GAREDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAA
GGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFII
ATFTDFTYVNNVSGFPIIRDQIFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVGEFPIISPGRVYEYTSC
TTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEYEEMEEE
EEEEEEEEDDEDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences ENSMICP00000011598 ENSMICP00000011598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]