SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011847 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011847
Domain Number 1 Region: 1776-1856
Classification Level Classification E-value
Superfamily E set domains 2.33e-17
Family E-set domains of sugar-utilizing enzymes 0.01
Further Details:      
 
Domain Number 2 Region: 1102-1180
Classification Level Classification E-value
Superfamily E set domains 0.000000000000205
Family E-set domains of sugar-utilizing enzymes 0.013
Further Details:      
 
Domain Number 3 Region: 1185-1265
Classification Level Classification E-value
Superfamily E set domains 0.000000000000318
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 
Domain Number 4 Region: 1694-1769
Classification Level Classification E-value
Superfamily E set domains 0.0000000000178
Family E-set domains of sugar-utilizing enzymes 0.0096
Further Details:      
 
Domain Number 5 Region: 1511-1593
Classification Level Classification E-value
Superfamily E set domains 0.0000000000382
Family E-set domains of sugar-utilizing enzymes 0.05
Further Details:      
 
Domain Number 6 Region: 1604-1691
Classification Level Classification E-value
Superfamily E set domains 0.0000000000433
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 
Domain Number 7 Region: 216-283
Classification Level Classification E-value
Superfamily E set domains 0.0000000000906
Family E-set domains of sugar-utilizing enzymes 0.026
Further Details:      
 
Domain Number 8 Region: 316-375
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.000000000111
Family Anthrax protective antigen 0.013
Further Details:      
 
Domain Number 9 Region: 1011-1086
Classification Level Classification E-value
Superfamily E set domains 0.000000000882
Family E-set domains of sugar-utilizing enzymes 0.024
Further Details:      
 
Domain Number 10 Region: 1277-1334
Classification Level Classification E-value
Superfamily E set domains 0.0000000153
Family E-set domains of sugar-utilizing enzymes 0.019
Further Details:      
 
Domain Number 11 Region: 88-187
Classification Level Classification E-value
Superfamily E set domains 0.0000000296
Family E-set domains of sugar-utilizing enzymes 0.022
Further Details:      
 
Domain Number 12 Region: 3280-3346,3403-3463
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000926
Family Galacturonase 0.064
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000011847
Domain Number - Region: 2035-2065
Classification Level Classification E-value
Superfamily E set domains 0.00168
Family Cellulosomal scaffoldin protein CipC, module x2.1 0.064
Further Details:      
 
Domain Number - Region: 16-69
Classification Level Classification E-value
Superfamily E set domains 0.0296
Family E-set domains of sugar-utilizing enzymes 0.067
Further Details:      
 
Domain Number - Region: 2436-2476,2511-2631
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0298
Family Pectate transeliminase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011847   Gene: ENSMICG00000012952   Transcript: ENSMICT00000013000
Sequence length 4191
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1459:196894:385068:1 gene:ENSMICG00000012952 transcript:ENSMICT00000013000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSQANQFNYGVDNTELGNSVQLVSSFQSITCDVEKDASHSTQITCYTRAMPEDSYTVRVS
VDGVPIAENNTCKGHINSWACSFNAKSFRTPTIRSITPLSGTPGTLITIQGRLFTDVYGS
NTALSSNGKNVRILRVYIGGMPCELLIPQSDNLYGLKLDHPNGDMGSMICKTTGTYIGKC
HHNVSFILDSDYGRSLPERMAYFVSSLNKISMFQTYAEITTISPSQGSVRGGTTLTISGR
FFDQTDFPAKVLVGGQACDILNVTENSILCKTPPKPQILKTVYPGGRGLKLEVWNNSRPV
HLKAILEYNEKTPGYMGASWLDSASYSPMEQDTFVARFSGFLVAPESDVYIFYIKGDDHY
ALYFSQTGLPEDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYIEILLQEYRLSAFV
DVGLYQYRNVYSEQQTGDAVNEEQVIKSQSTIIQEVQVITLENWETTNAINEVQKIKVTS
PCVEANSCSLYQYRLIYNMEKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXDFDLLGYEVFEGNNVTLDITEQTKGKPSLETFTLNWDGIVSKPLTPQSS
EAEFQVAVEEMVSTKCPPEIANFEEGFVVKYFRDYETDFNLXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXWTYTCIDLLDLIQTKYTGTNFSLQRISLQKASESQSFYVDIVYIGQT
STISTLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXSNWPGESKIRIQRIQAASPPLSGSFDIQAYGHNLIXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINDSNIIGEKANMT
VTKIKEGGLFRQHILGDLLRTPSQHPQVEVYINEIPAKCSGDCAFTWDSRITPSVLATSP
HQGSYEESTILTIVGSGFSPSPAVSVSVGPIGCPLLSVDENEIKCQILNGSAGRALIAVS
VAGFGLAQSVGVENFHFVYQSKISHIWPDSGSLAGGTLLTLSGFGFNENSMVLVGNETCN
VIEGDWNGITCRTPKRIEGTVDISVITNGFQATAKDAFSYNCLQTPVITDFSPKVQTILE
EVNLTIKGYNFGNELTQDMVVYVGGKTCQILHWNFTDIRCLSPKLSPGKHDIYVEVRNWG
FASTRDKLNASIQYVLEVTNMFPQRGSLYGGTEITVMGFGFSPIPTENTVLLGSFPCNVI
SSSEKVIKCTLQSTGNVFRITNNGEDSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFSYQFTSPGIHYYSSGYVDEANSIFLQG
VINVLPAESRHIPLHLFVGSTEATYAQGGPEILHLGSSVAGCLATEPVCGLNNTGVKNSK
RLLFELSSCFSPSISNITPSTGTVNELITITGHGFSNLTCANKVTIGGYPCVVEESNDSS
IMCHIDPQNSMDVGIREIVTVTVYNFGTAINILSNEFYRRFVLLPNIDMVLPNAGSTTGM
TRVTIKGSGFAVSSAGVEVLMGHLPCKVLSVNYTAIECETSPAPQHLVIVDLLIHGVPAQ
CQGNCSFSYLESITPYITRVFPDSIQGSERVLIEGEGFGTDLEEITVFIGNQQFRAIDVN
ESNITILVPPLPAGLHSIIVVVGTKGLALGNLTVSSPAVASVSPTSGSIGGGTVLVITGN
GFYPGNTTVTIGDDPCQIISVNSSEIYCHTPAGTAGMVSVKILVNAIAYPPLPFTYTLED
TPFLRGIVPSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXRGPEQACEVSVVNGNDMSQSTTPFTYMESLTPFIT
AVSPKSGSTAGGTRLTVVGSRFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGTEASPFQHKAVITLHGHLRSPELP
VYGAKTLAVREGILDLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XHSQRENEKRTIASVSVDGINITLTNPLNYTHLGITVTLPDGTXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXEFATQTCLQGKFGEEIGSDQFGGCIMFHAPVPGTNMVT
GRIEYVEVFHAGQAFRLGRYPIHWHLLGDLQFKSYVRGCAIHQTYNRAVTIHNTHHLLVE
RNIIYDIKGGAFFIEDGIEYGNILQYNLAVFVQQSTSLLNDDVTPAAFWVTNPNNTIRHN
AAAGGAHFGFCSRMNKKTPPSEKTFNICQKRVPLGEFFNNTVHSQGWFGLWIFEEYFPMQ
TGSCTSTVPEPAVFNSLTTWNCQKGAEWVNGGALQFHNFVMVNNNEAGIETKRILAPYVG
GWGETNGAVIKNAKIVGHLDELGMGSAFCTTKGLVLPFSAGLTVSSVHFMNFDRPNCAAL
GVTSITGVCNERCGGWSAKFVDIQYFDTPNKAGFRWEHEVMLIDIDGSLTGYKGHTVIPH
SSLLDPSHCTQEAEWSIGFAGSVCDASVSFHRLAFNKPSPVSLLEKDVVLSDSFGTSIVP
FQKKRLTHMSGWMALIPNANHINWYFKDMDHITNISYTSTFYGFKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWSNDSFWQSSRENNYTVPRPGAN
VVIPEGTWIVADTDMPPMERLIIWGVLELEDNYNGAPESSYRKVVLNATYISLQGGRLIG
GWEDDPFKGELKIVLRGNHSTPEWALPEGPNQGAKVLXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXEGEEIVITTTSYDSHQTETRSIVKILHNHKILILNDSLSYTHL
AERYHVPETGQSYTLAADVGILTRNIKIVGEDYPGWSEDSFGARVLVGSFSENMITFKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQEHGASYIRGCAFHYSFSPAIGVFGT
DGLDIDDNIVYFTVGEGMRIWGDANRVRGNLVALSVWPGTYQNRKDLSSTLWHAAIEXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXQSNPTEKWFDNEAHGGLYGIYMNQDGLPGCSL
IQGFTIWTCWDYGIYFQTTESVHIYNVTLVDNGMAIFPMIYTPAAVSHKIASKKVQIKSS
LIVGSSPEFNCSDVLTDNDPNIELTVAHRSPRPPTGGRSGICWPTFASAHNMAPRKPHAG
IMSYNAICGLLDVSGKCSTFVGFKNVCSGETNVIFITNPLNEDLQHPIHVKNIQLVDTTE
QSKIFIHRPDISKANPSDCVDMVCDAKRKSFLRDLDGSFLGNPGSVIPQAEYEWNGNSQL
GIGDYRIPKVMLTFLNGSRIPVTEKAPYKGIIRDSTCKYIPEWQSYECFGMEYAMMVIES
LDSDTETRRLSPVAVVSNGYVDLINGPQDHGWCAGYTCQRRLSLFHSIVALNKSYEVYFT
GTSPQNLRLMLLNVDHNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKH
LYTEQFLPNLDSTVLGENYFDRTYQMLYLLVKGTIPVEIHTATVIFVAFQLPTVTEDDFY
SSHNLVRNLALFLKIPSDKIRISKIVRGKSLRRKRSTGVTIELEIGDPPTQFLSNDTTGS
LQLSELQEIASSLGQAVILGKTGNILGFNISSMSITNPLPSPGDSGWIKVTAQPVERSAF
PVHHVAFVSSLLVITQPVAAQPGQPFSQQPSVKAVDSEGNCVSVGVTMLTLKAILKDSNN
NQVSGLTGNTTIPFSSCWANYTDLTPLRTGKNYKIEFILDNVVRVESRTFNLPAQSVSSS
SSSSSSNSKATTVGTSAQIMSTVISCLIGKMLLLEIFMAAVFVLNVTIGCN
Download sequence
Identical sequences ENSMICP00000011847 ENSMICP00000011847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]