SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012139 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012139
Domain Number 1 Region: 29-141
Classification Level Classification E-value
Superfamily FKBP-like 5.5e-40
Family FKBP immunophilin/proline isomerase 0.00000113
Further Details:      
 
Domain Number 2 Region: 254-414
Classification Level Classification E-value
Superfamily TPR-like 1.19e-32
Family Tetratricopeptide repeat (TPR) 0.0000000648
Further Details:      
 
Domain Number 3 Region: 146-251
Classification Level Classification E-value
Superfamily FKBP-like 1.83e-20
Family FKBP immunophilin/proline isomerase 0.00000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012139   Gene: ENSMICG00000013310   Transcript: ENSMICT00000013312
Sequence length 455
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_668:8588:105481:-1 gene:ENSMICG00000013310 transcript:ENSMICT00000013312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDEGAKNNGESPAATVAEQGEDITSKKDRGVLKIVKRVGSSEEMPMIGDKVYVHYKGK
LSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEVCHLLCKPEYAYGSAGSLP
KIPSNATLFFEIELLDFKGEDLFEDGIIRRIKRKGGYSNPNEGXXXXXHLEGRCGERMFD
CRNVVFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELI
YEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTLYFKGGKYMQAVIQYGKIVSWLEMEY
GLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQL
LMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRKIYANMFKKFAEQDAK
EEASRAMGKKTLEGVTNEKETENQAMEEEKPEGHV
Download sequence
Identical sequences ENSMICP00000012139 ENSMICP00000012139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]