SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012199 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012199
Domain Number 1 Region: 17-172
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.58e-43
Family Carbonic anhydrase 0.0000057
Further Details:      
 
Domain Number 2 Region: 243-285
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.00000995
Family Carbonic anhydrase 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012199   Gene: ENSMICG00000013382   Transcript: ENSMICT00000013377
Sequence length 313
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3353:24198:32659:1 gene:ENSMICG00000013382 transcript:ENSMICT00000013377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLALLALAADGASATEDLHWCYQVQAQASNCLGPANWGEHCQQSRQSPIDIVTNKAK
ANENLRPFSFSGYDKKLEWTVQNNGHTVVMSPTTNGIEIAIAGGGLSARYQVTQFHLHWS
RVMNAGSEHSINGKRFAMEMHIVHQKEKGTSGNNNNTQNPGNDIAVLGFLVTXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXIELHTDQILAFSDKLFYDTERRLKMTDNVRPVQALGQRTVFKSQAPGQLLPLPLPALL
VPTLTCLAAGFLW
Download sequence
Identical sequences ENSMICP00000012199 ENSMICP00000012199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]