SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012230 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012230
Domain Number 1 Region: 11-274
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.26e-49
Family Extradiol dioxygenases 0.000000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012230   Gene: ENSMICG00000013416   Transcript: ENSMICT00000013411
Sequence length 363
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2858:1115:10878:-1 gene:ENSMICG00000013416 transcript:ENSMICT00000013411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYSNKGAKPERGRFLHFHSVTFWVGNAKQAAAFYCSKMGFEPLAYRGLETGSREVVSH
VIKQGQIVFVLSSALNPWNKEMGDHLVKHGDGVKDIAXXXXXXXXXXXYGDTTHTLVEKM
GYTGRFLPGFEAPAFKDPLLPKLPNCTLEIIDHIVGNQPDQEMVPASEWYLKNLQFHRFW
SVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALK
TQDIITAIRHLRERGTEFLAVPSTYYKQLREKLKTAKIRVKENIDVLEXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNGVV
PGM
Download sequence
Identical sequences ENSMICP00000012230 ENSMICP00000012230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]