SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012400 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012400
Domain Number 1 Region: 5-358
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.04e-51
Family Extradiol dioxygenases 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012400   Gene: ENSMICG00000013600   Transcript: ENSMICT00000013591
Sequence length 371
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4605:18233:19348:1 gene:ENSMICG00000013600 transcript:ENSMICT00000013591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPARRLCHIAFHVPAGQPLARDLQRLFGFQPLAAREADGWRQLALRSGDAVFLVNEGE
GPGEPLYCLDPRHAVPSATNLCFDVANAGAAARALAARGCRVPVPPVSVQDARGAATYAV
VSSPAGNLSLTLLERADYRGTFLPGFEPVSSAPGPGWVSHVDHLTLACTPGSSPTLLRWF
HDCLGFCHLPLSPGEDPELGLEVAAESGRGGLRLTALQTPPGSLVPTLVLAESLPGAARG
QDQVEQFLARHRGPGLQHVGLYTPNIMEATEGVVGAGGQLLTPPEAYYQQPGKERQILEA
GREPSLLARQGILLDGDKGKFLLQVFTKSLFAEDTFFLELIQRQGATGFGQGNIRALWQS
VQEQAARSQEA
Download sequence
Identical sequences ENSMICP00000012400 ENSMICP00000012400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]