SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012413 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012413
Domain Number 1 Region: 89-308
Classification Level Classification E-value
Superfamily DNA-glycosylase 7.07e-68
Family Mismatch glycosylase 0.0000247
Further Details:      
 
Domain Number 2 Region: 355-492
Classification Level Classification E-value
Superfamily Nudix 1.5e-27
Family MutY C-terminal domain-like 0.00000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012413   Gene: ENSMICG00000013605   Transcript: ENSMICT00000013605
Sequence length 550
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4605:20197:29689:-1 gene:ENSMICG00000013605 transcript:ENSMICT00000013605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPRVSSLCRLWAMRKPRAAMGSGHRKQAASQEGRKKRALGSSQAKPSDPDGKIPECPEV
SAGLARQPEEVVLQASISPYHLFRDTAEVTAFRGKLLSWYDREKRDLPWRRRAEDEVDLD
RRAYAVWVSEVMLQQTQVATVINYYTRWMQKWPTLQDLASASLEEVNQLWAGLGYYSRGR
RLREGAQKVVEELGGHMPRTAETLQRLLPGVGRYTAGAIASIAFGQATGVVDGNVVRVLC
RVRAIGADPSNTVISQQLWSLAQQLVDPARPGDFNQAAMELGATLCTPQRPHCTQCPVQS
LCRAHQRVEREQLSASRSLLGSPDVEECAPTTGQCQLCLPTTEPWDRTLGVANFPRKASR
RPPREECSATCVLEQPRALGGARILLVQRPKSGLLAGLWEFPSVTLEPSEKNQYEALLQE
LQSWAGPLPAAHLRHLGEVVHIFSHIKLTYQVYGLTLEGQSPVTTTPPGARWLTREEFHT
AAVSTAMKKALPXXVFRVYEGQQPGTCKGSKRSQVSIPSGRKKTSRGQQVLDSFFQPLVS
TDAPINSVAE
Download sequence
Identical sequences ENSMICP00000012413 ENSMICP00000012413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]