SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012428 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012428
Domain Number 1 Region: 369-493
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.06e-31
Family Phosphate binding protein-like 0.00018
Further Details:      
 
Domain Number 2 Region: 1-345
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.69e-25
Family L-arabinose binding protein-like 0.0058
Further Details:      
 
Domain Number 3 Region: 654-732
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000000000315
Family Phosphate binding protein-like 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012428   Gene: ENSMICG00000013627   Transcript: ENSMICT00000013622
Sequence length 788
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3990:35136:410969:-1 gene:ENSMICG00000013627 transcript:ENSMICT00000013622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNPGGSPRTACHLNPSPDGEAY
TLASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQSFLDQASRLGLDVSLQKVDK
NISHVFTSLFTTMKTEELNRYRDTLRRAILLLSPQGAHSFINEAVETNLASKDSHWVFVN
EEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCMRNNHRISSLLCDPQEGYLQMLQIS
NLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWNGGRSMLDTIKKGHITGLTG
VMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERXXXXXXXXXXX
XXXXXXEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNT
SWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIRKPEEKISIFSLFA
PFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASATLHSAIWIVYGAFVQQ
GGESSVNSVAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKKGNYAF
LWDVAVVEYAALTDDDCSVTVISNSVSSKGYGIALQHGSPYRDLFSQRILELQDTGDLDV
LKQKWWPHTGRCDLTSHASAQADGKSLKLHSFAGVFCILAIGLLLACLVAALELWWNSNR
CHQETPKE
Download sequence
Identical sequences ENSMICP00000012428 ENSMICP00000012428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]