SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012438 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012438
Domain Number 1 Region: 96-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000556
Family VPS37 C-terminal domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012438   Gene: ENSMICG00000013642   Transcript: ENSMICT00000013633
Sequence length 217
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3017:87971:94103:-1 gene:ENSMICG00000013642 transcript:ENSMICT00000013633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLKDKTLQELEEMQNDSAVIDQLALESCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFSSALQPGALLDLLQIEGMKIEEESEAMAE
KFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGDAPPPRPPPPPR
PAPQATLPVAEEQPQPPSAVPPYPLPYSPSPSMPVGP
Download sequence
Identical sequences ENSMICP00000012438 ENSMICP00000012438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]