SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012457 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012457
Domain Number 1 Region: 412-615
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.91e-43
Family Protein kinases, catalytic subunit 0.0000345
Further Details:      
 
Domain Number 2 Region: 280-363
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-34
Family Kringle modules 0.00035
Further Details:      
 
Domain Number 3 Region: 30-118
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-20
Family I set domains 0.032
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000012457
Domain Number - Region: 139-226
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00301
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012457   Gene: ENSMICG00000013653   Transcript: ENSMICT00000013655
Sequence length 903
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2172:445153:595212:1 gene:ENSMICG00000013653 transcript:ENSMICT00000013655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TESSVTAELVPTSSWNISSELDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRW
FKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFX
XXXXXXXXXXDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGT
SSHLSDKCSQFAIPSLCHYAFPYCDETSAVPKPRDLCRDECEILENVLCQTEYIFARSNP
MILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNNTGVDYRGTVSVTKSG
RQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC
DSKDSKEKNKMEILYILVPSVAIPLAIALLFFFICVCRNNQKSSSPPVQRQPKHVRGQNV
EMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLYLPGMDHAQLVAIKTLKDY
NNPQQWTEFQQEASLMAELHHPNIVCLLGAVTQEQPVCMLFEYTNQGDLHEFLIMRSPHS
DVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILIGEHFHVKI
SDLGLSRRIYADYYVQSRSLLPIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQGITPQGQIAGFIGPPIPQN
QFIPINGYPIPPGYAAFPAAHYQPAGPPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSS
GSNQEANIPLLPHMSIPNHPSGMGITVFGNKSQKPYKIDSKQPSLLGDSNIHGHTESMIS
AEL
Download sequence
Identical sequences ENSMICP00000012457 ENSMICP00000012457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]