SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012512 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012512
Domain Number 1 Region: 376-507
Classification Level Classification E-value
Superfamily C-type lectin-like 1.41e-41
Family C-type lectin domain 0.0000877
Further Details:      
 
Domain Number 2 Region: 235-368
Classification Level Classification E-value
Superfamily C-type lectin-like 3.04e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 518-653
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-34
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 4 Region: 827-954
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-33
Family C-type lectin domain 0.0003
Further Details:      
 
Domain Number 5 Region: 966-1117
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-33
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 6 Region: 1257-1395
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-26
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 7 Region: 42-172
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.49e-24
Family Cysteine rich domain 0.0031
Further Details:      
 
Domain Number 8 Region: 1129-1250
Classification Level Classification E-value
Superfamily C-type lectin-like 1.26e-21
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 9 Region: 172-230
Classification Level Classification E-value
Superfamily Kringle-like 2.28e-20
Family Fibronectin type II module 0.00087
Further Details:      
 
Domain Number 10 Region: 659-731
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000742
Family C-type lectin domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012512   Gene: ENSMICG00000013679   Transcript: ENSMICT00000013715
Sequence length 1478
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2460:80367:133540:1 gene:ENSMICG00000013679 transcript:ENSMICT00000013715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGPGRRAQAPWPRHLLGWPLVLGGLHLGRPGPPGDAALXXPNVFLIFSHGLQGCLEAQGG
QVRVTPACNASLPAQRWKWVSRNRLFNLGTMQCLGTGWPGTNTTASLGMYECDREALNLR
WHCRTLGDQLSLLLGGRAGNFSKPGTLERGDQTRGGQWRIYGSEEDLCARPYYEVYTIQG
NSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWD
KDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGL
NDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCK
KKPNATAEPIPPDKWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLLSI
HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLED
CVTIWGPEGRWNDSPCNQSLPSICKKVGQPSQGAAEEDHGCRKGWKWHSPSCYWLGEDQV
TYSEARRLCTEQGSQLVTITNRFEQAFVNSLIYTWEGEHFWTALQDLNSTGSFRWLSGDE
VMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPD
PTPSLTGACPQGWASDPKLRHCYKVFSSDRLQDKKSWIQAQGACRELGAQLLSLASYEEE
HFVANMLNKIFGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADVQEPDDSTQGGREWLRFQEAEYKFF
EHHSTWVQAQRICTWFQAELTSVHSQAELDFLGHNLQKFSRGQEQHWWIGLHTSENDGRF
RWTDGSVINFISWAPGKPRPVGKDRKCVYMTTSREDWGDQRCLTDLPYICKRSNGTREPQ
PPEMPPTALGGCPSGWDQFLTKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQ
AFITASLPNVTFDLWIGLHAAQRDFQWVEQEPLLYTNWAPGEPSGPSPAPSGNKPTSCAV
ILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAASPPAPGAELSYNGTFRLLQ
KPLRWHDALLLCESRNASPGRVPGPYTQAFLTQAARGLRTPLWIGLASEEGSRRYSWVSE
EPLSYASWQDGEPQQPGGCAYVDVDGTWRTTSCDTKLQGAVCGVDSGPPPSRKISYHGSC
PQSLADSAWIPFREHCYSFHMELLLGHKEALQRCQRAGGAVLSIRDEMENVFVWEHLQSS
EGQSRGAWLGMNFNPKGGTLVWHDNTAVNYSNWGSPGLGPSMLSHNSCYWIQSSSGLWRP
GACTNITMGVVCKLPRAQESDSPATALPENPAALVVVLMAVLLLLALLTAALILYRRRQS
MEQGAFEGARYSRSSSGPCEATEKNILVSDMEMNEQQD
Download sequence
Identical sequences ENSMICP00000012512 ENSMICP00000012512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]