SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012517 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000012517
Domain Number - Region: 247-346,430-531,584-601,841-917
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000863
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012517   Gene: ENSMICG00000013703   Transcript: ENSMICT00000013720
Sequence length 1124
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3017:214178:246424:-1 gene:ENSMICG00000013703 transcript:ENSMICT00000013720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVVYMHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDL
LFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLY
DGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVS
LREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQS
TIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTY
LDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWPLRSEPNRETDDTLVLSFVGQTRVL
MLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQGK
NISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLC
AIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGL
NIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEV
NYMCPLNSDGYPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
KLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIMALYLKT
KGDFILVGDLMRSVLLLAYKPMEGNFEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGM
IGLVTSLSESWYNLLLDMQNRLNKVIKSKGKKPKSYWKSFHTERKTEPATGFIDGDLIES
FLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
Download sequence
Identical sequences ENSMICP00000012517 ENSMICP00000012517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]