SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012560 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000012560
Domain Number - Region: 426-452
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0157
Family RILP dimerisation region 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012560   Gene: ENSMICG00000013743   Transcript: ENSMICT00000013770
Sequence length 1251
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_63:81755:229273:-1 gene:ENSMICG00000013743 transcript:ENSMICT00000013770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESL
ESQTRQLELKAKNYADQXXXXXXXXXXXXXXXXXXXXXXXXMIHNYMEHLEXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXDELSDVSQGGSKATTPASTANSDVATIPTDTPLKEDNEGFVKITDTTNKSEISKHIE
VQVAQETRNVSTGNAENEEKSEVQAIIESTPELDMDKDLSGYKGSXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXMGREVENLILENTQLLETKNALNVVKNDLIAKV
DELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDDDDSDIPTA
QRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT
EASLASRREQKREQYRQVKAHVQKEDGRVQAFGWSLPQKYKQXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXEQQKELKNQEELSSLVWICTSTHSATKVIIIDAIQPGNILDSFSVCNSHILC
IASVPGARETDYPAGEDLSESGQVDKASLCGSVTSNSSAETDSLLGGITVVGCSAEGVTG
AATSPSTNGASPVIEKPPEMEPENSEVDENVPTAEEATEATEGNAGSAEDTVDISQTGVY
TEHVFTDPLGVQIPEDLSPVYQSSNDSEAYKDQIPVLPSEQDLVREEAQKMSSLLPTMWL
GAQNGXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVKGIVLVALADGTLAIFHRGVDGQWD
LSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIEAXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXQVISPLSGTSGTDLTADAGPILPQESASQTPIGRLMLV
IXXXXXXXXXXXXDEGGESELLGEDLPLEPSVTKAERSHLIVWQVMYYKYE
Download sequence
Identical sequences ENSMICP00000012560 ENSMICP00000012560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]