SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012629 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012629
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 4.76e-52
Family Ran-binding protein mog1p 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012629   Gene: ENSMICG00000013849   Transcript: ENSMICT00000013843
Sequence length 186
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1846:319132:320516:1 gene:ENSMICG00000013849 transcript:ENSMICT00000013843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTRDYPLFGGAFSAILPPGTIDVSDLRPVSDNRDVICHPVTDQSLIVELLELQAHVGG
EAAARYHFEDVGGVQGARAVQVESVRPLSLENLALRSCCQEAWVLSGKQQVAKENQQVAK
DVTLHQALLRLHQYQTDLLLTFNQPPPDNRSSLGPENLSPPPWSLGDFEQLVASLTLHDP
NIFGPQ
Download sequence
Identical sequences ENSMICP00000012629 ENSMICP00000012629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]