SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012638 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012638
Domain Number 1 Region: 347-444
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000188
Family Fungal lipases 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000012638
Domain Number - Region: 278-324
Classification Level Classification E-value
Superfamily DNA-glycosylase 0.0942
Family Mismatch glycosylase 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012638   Gene: ENSMICG00000013847   Transcript: ENSMICT00000013852
Sequence length 1040
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3017:776745:808118:1 gene:ENSMICG00000013847 transcript:ENSMICT00000013852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGIVVFRRRWSVGSDDLVLPAIFLFLLHTTWFVILSVVLFGLVYNPHEACSLNLVDHGR
GYLGILLSCMIAEMAIIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLT
QYYTSCNDLTAKNVTLGMVVCNWVVILSVCITVLCVFDPGRTFVKLRATKRRQRNLRTYN
LRHRLEEGQATSWSRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGLV
LLRQRQRAKRNAVLDEANNDILAFLSGMPVTRNTKYLDLKNSHEMLRYKEVCYYMLFALA
AYGWPMYLMRKPACGLCQLARSCSCCLCPARPRFAPGVTIEEDNCCGCNAIAIRRHFLDE
NMTAVDIVYTSCHDAVYETPFYVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVEG
HHGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXCIPKSELPEEVEVTTLANTRLWTHPSDLTIALSASTPLYP
PGRIIHVVHNHPAEQCCCCEQEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLNK
VLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPLPTGPPMPAGLALELPAADHRNS
SVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFYIDPAIPEENPSLSSRTELL
AADSLSKHSQDTQPLEAALGSGGVTPERPPSVANEEEEEVGGGGGGAAPCGELALHNGRL
GDSPSPQVLEFAEFIDSLFNLDSKSSSFQDLYCMVVPESPTSDYTEGPKSPSQQEILLRA
QFEPNLVPKPPRLFAGSADPSSGISLSPSFPLSSSGELMDLTPTGLSSQECLAADKVRTS
TPTGRGASPAKQDELVISAR
Download sequence
Identical sequences ENSMICP00000012638 ENSMICP00000012638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]