SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012642 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012642
Domain Number 1 Region: 115-249
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 8.24e-30
Family Glutaminase/Asparaginase 0.0000437
Further Details:      
 
Domain Number 2 Region: 2-69
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 5.76e-26
Family Glutaminase/Asparaginase 0.00021
Further Details:      
 
Domain Number 3 Region: 302-340
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000529
Family Ankyrin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012642   Gene: ENSMICG00000013859   Transcript: ENSMICT00000013856
Sequence length 340
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3282:413:15786:1 gene:ENSMICG00000013859 transcript:ENSMICT00000013856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHYEQYHGFVVIHGTDTMAFAASALSFLLENLQKTVVLTGAQVPIHALWSDGRENLLGAL
LMAGQYVIPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRELVRK
VGRKARLVVHDSMERDVGLLRLYPGIPAALVRAFLQPPMKGLVMETFGSGNGPTKPDLLW
ELRAAAERGLVIVNCTHCLQGAVTSDYATGMAMAGAGIISGLDMTSEAALAKLSYVLGQP
GLSLDDRKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEADAVRDALA
PSLACAAAHAGDLEALQVLEEMGSDLSLEDFRGQTPLHAA
Download sequence
Identical sequences ENSMICP00000012642 ENSMICP00000012642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]