SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012690 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012690
Domain Number 1 Region: 500-712
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-54
Family Protein kinases, catalytic subunit 0.00000193
Further Details:      
 
Domain Number 2 Region: 281-369
Classification Level Classification E-value
Superfamily Kringle-like 9.91e-35
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 30-119
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-21
Family I set domains 0.028
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000012690
Domain Number - Region: 141-228
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0418
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012690   Gene: ENSMICG00000013912   Transcript: ENSMICT00000013916
Sequence length 908
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3420:17359:68860:-1 gene:ENSMICG00000013912 transcript:ENSMICT00000013916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVEVPGPKDPLGPLDGQDSPIPTLKGYFLSFLEPVNNITIVQGQTAILHCKVAGNPPPNV
RWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGVKTITATGVLFVR
LXXXXXXXXXXXDDSHEDGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTMI
GTSTHLSDQCSQFAIPSFCHFVFPLCDARSRAPKPRELCRDECEVLESDLCRQEYTIARS
NPLILMQLQLPKCEALPMPDSPDAASCMRIGIPAERLGRYHQCYNGSGSDYRGTASTTKS
GHQCQPWALQHPHSHHLSSTDFPELGGGHAYCRNPGGQMEGPWCFTQNKNVRVELCDVPS
CSPQDSSKMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASASSPQRRQLMASPSQDME
MPLIGQHKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXPNIVCLLGVVTKDQPLSMVFGYCHGDLHEFLVMRSPHSDV
GSTDDDRTVKSALEPPDFVHVAAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLSVKISDL
GLFREVYSADYYKLLGNSLLPIRWMSPEAITYGKFSTDSDIWSYGVVLWEVFSYGLQPYC
GYSNQDVVEMVRSRQLLPCPDDCPAWVYALMVECWSEFPGRRPRFKDLHGRLRACGSLSN
CTSSAQTSGASNATQTSSLSTSPVSNVSNARYPGPKQKAQPFPQPAFIPMKGPVRPLVPP
PQLYIPVNGYQPVPAYGPYLPGFYPVQIPMHMAPQQAPAPMAPKPSSHHSGSGSTSTGYV
TTAPSNTSVADRAALLSEGPEDTHNVPEDPAQSPVQEAEEEEEGSVPETELLGDSDTLQV
DEAQGLEA
Download sequence
Identical sequences ENSMICP00000012690 ENSMICP00000012690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]