SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012834 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012834
Domain Number 1 Region: 114-158
Classification Level Classification E-value
Superfamily LysM domain 0.0000000183
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012834   Gene: ENSMICG00000014076   Transcript: ENSMICT00000014077
Sequence length 942
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4292:2058853:2172423:1 gene:ENSMICG00000014076 transcript:ENSMICT00000014077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKEEKKERKQSYFARLKKKKQAKQNAETGSAIAARTHTGKEDANAVILEQDKCNIAVE
EEYITDEKKKRKTNQLKEIRRTELKRYYSIDDNQNKTHDKKEKKMVVQKPHGTMEYTAGS
QDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANFPSSTLRLSSSSPGATVSP
SSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVM
IVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQD
LCPLYRPGEWEDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLGEDDDFVDLQ
ELSSQTDSGLNKRDTSKECLSLDPEELKRAELQRINSAMEMQVQSALNFSGTGNDAELKG
ALDLEACEKQDIMPEVDKQSGSPESQVENTLNIHEDLDKVKLIEYYLHKNKEGSQLSENL
QKTELSDGKSIEPEGIDITLSSSVSQAGDPSIEGNKEPDKTSVKEGEPLPMKLDSSTEEN
MIKESLDSPLESTLDNSCPGTQTDNKSEIQLWLLKRIQVPIEDILPSKEEKSKTPPMFLC
IKVGKPMRKSFATHTAAMVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDAK
EQGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEDEEDEVLPILQPHS
ALLENMHIEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XIFGAYATHPFKFSDHYYGTGETFLYTFSPNFKVFKWSGENSYFINGDISSLELGGGGGR
FGLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWTFE
Download sequence
Identical sequences ENSMICP00000012834 ENSMICP00000012834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]