SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013254 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013254
Domain Number 1 Region: 397-462,579-739
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 5.62e-99
Family Substrate-binding domain of HMG-CoA reductase 0.00000000313
Further Details:      
 
Domain Number 2 Region: 465-581
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 3.53e-45
Family NAD-binding domain of HMG-CoA reductase 0.000000531
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000013254
Domain Number - Region: 30-96
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0549
Family Multidrug efflux transporter AcrB transmembrane domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013254   Gene: ENSMICG00000014536   Transcript: ENSMICT00000014541
Sequence length 766
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1215:55765:70696:1 gene:ENSMICG00000014536 transcript:ENSMICT00000014541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EALPFFLLLIDLSRASALAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVG
TMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLELELSRESREGRPIWQLSHFARFL
EEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTAENSKVSLGLDENVSKRIE
PSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQAETESTLSLKNPITSPVVTQK
KVPDNCCRREPILVRNNQKFHSAEEETGVNQEKKVEVIKPLVAETDTPNRATFVVGNSAL
LNTSSELATQEPENELPKEPRPNDECIQILGNPEXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVMGACCENVIGYMPIPVGVAG
PLCLDGKEFQVPMATTEGCLVASTNRGCRAIGLGGGASSRVLADGMTRGPVVRFPRACDS
AEVKAWLETPEGFTAIKEAFDSTSRFARLQKLHMSIAGRNLYIRFQSRSGDAMGMNMISK
GTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLK
TTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLME
ASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIV
CGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQETCTKKTV
Download sequence
Identical sequences ENSMICP00000013254 ENSMICP00000013254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]