SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013331 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013331
Domain Number 1 Region: 1419-1590
Classification Level Classification E-value
Superfamily Fibronectin type III 4.69e-28
Family Fibronectin type III 0.00000868
Further Details:      
 
Domain Number 2 Region: 778-957
Classification Level Classification E-value
Superfamily Fibronectin type III 3.19e-27
Family Fibronectin type III 0.00092
Further Details:      
 
Domain Number 3 Region: 1861-2028
Classification Level Classification E-value
Superfamily Fibronectin type III 1.51e-24
Family Fibronectin type III 0.00000981
Further Details:      
 
Domain Number 4 Region: 1233-1407
Classification Level Classification E-value
Superfamily Fibronectin type III 3.63e-23
Family Fibronectin type III 0.00000791
Further Details:      
 
Domain Number 5 Region: 1602-1756
Classification Level Classification E-value
Superfamily Fibronectin type III 2.36e-22
Family Fibronectin type III 0.00000972
Further Details:      
 
Domain Number 6 Region: 376-431
Classification Level Classification E-value
Superfamily Kringle-like 9.14e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 7 Region: 316-371
Classification Level Classification E-value
Superfamily Kringle-like 1.43e-20
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 8 Region: 963-1052
Classification Level Classification E-value
Superfamily Fibronectin type III 3.42e-20
Family Fibronectin type III 0.0005
Further Details:      
 
Domain Number 9 Region: 1766-1856
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-19
Family Fibronectin type III 0.00000401
Further Details:      
 
Domain Number 10 Region: 525-571
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000249
Family Fibronectin type I module 0.0025
Further Details:      
 
Domain Number 11 Region: 2264-2307
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000275
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 12 Region: 483-527
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000314
Family Fibronectin type I module 0.0047
Further Details:      
 
Domain Number 13 Region: 586-668
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000317
Family Fibronectin type III 0.00000415
Further Details:      
 
Domain Number 14 Region: 198-241
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000589
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 15 Region: 61-106
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000157
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 16 Region: 435-476
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000157
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 17 Region: 703-792
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000204
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 18 Region: 152-195
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000068
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 19 Region: 18-58
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000327
Family Fibronectin type I module 0.00019
Further Details:      
 
Domain Number 20 Region: 2307-2348
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000194
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 21 Region: 274-312
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000116
Family Fibronectin type I module 0.0003
Further Details:      
 
Domain Number 22 Region: 1170-1230
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000123
Family Fibronectin type III 0.0000328
Further Details:      
 
Domain Number 23 Region: 2121-2195
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000047
Family Fibronectin type III 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013331   Gene: ENSMICG00000014594   Transcript: ENSMICT00000014625
Sequence length 2399
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2114:808681:878582:-1 gene:ENSMICG00000014594 transcript:ENSMICT00000014625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQQIVEPQSPVAVSQNKPGCYDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPE
PEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKCFDHAAGTSYVVGETWEKPYQGWMMVD
CTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNMLQCICTGNGRGEWKCER
HASLQTTATGPGSFTDVRPAIYQPQPHPQPAPYGHCVTDSGVVYSVGMQWLKTQGNKQML
CTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNY
EQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNY
DADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYS
QLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETRTFYQI
GDSWEKYVHGVRYQCYCYGRGIGELHCQPLQTYPGTTGPVQVIITETPSQPNSHPIQWNA
PEPSHITKYILRWRPKNSVSNWKEATIPGHLNSYTIKGLKPGMIYEGQLISIQQYGHREV
TRFDFTTTSTSTPVTSNTVTGETTPLSPVVATSESVTEITASSFVVSWVSASDTVSGFRV
EYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISQEGEQSLILSTSQTTAPD
APPDPTVDQVDDTSIVVRWSKPQAPITGYRIVYSPSVEGSSTELNLPETASSVTLSDLQP
GVQYNITIYAVEENQESTPVFIQQETTGVPRADKVPPPKDLQFVEVTDVKVTIMWTPPDS
AVTGYRVDVIPVNLPGEHGQRLPISRNTFAEVTGLSPGVTYYFKVFAVNHGRESKPLTAE
QTTKLDAPSNLQFINETDTSVLVIWTPPRARIAGYRLTVGPTRGGQPKQYNVGPSASRYP
VRNLQPASEYTVTLVAVKDNQQSPKVTGVFTTLQPQSSIPPYNTEVTETTIVITWTPAPR
IGFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITGYRITTTPTNGQQGYSLEEVVHADQNSC
TFDNLSPGLEYNVSVYTVKDDKESVPISDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNS
STIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTL
TQQTAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDN
AVVLTNLLPGTEYLVSVSSVYEQHESIPLRGREKTGLDSPTGIDFSDITPNSFTVHWMAP
RTPISGYEIRHHPEHHSGRPRKDRVPPSRNSITLTNLLPGTEYVVSIIAVNGREESPPLV
GQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKS
TATISGLKPGVDYTITVYAVTGRGDSPASSKPISIDYRTEIDKPSQMQVTDVQDNSISVR
WLPSSSPVTGYRVTTTPKNQTEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTNIDR
PKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRP
GSEYTVSVVALHDDMESQPLIGTQSTAIPAPTNLKFIQVTPTSLSAQWTPPNVQLTGYRV
RVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENV
SPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQPPIQRTIKPDVRSYTITGLQ
PGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRAKITGYI
IKSEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYIIALKNNQKSEPLIGRKKTDEL
PQLVTLPHPNLHGPEILDVPSTVQKTPFITNPGYDTGNGIQLPGTSGQQPSVGQQMIFEE
HGFRRTTPPTTATPVRHRPRPYPPNVGQEALSQTTISWTPFQETSEYVISCHPVGIDEEP
LQFRVPGTSTSATLTGLTRGATYNIIVEALKDQKRHKIREEVVTVGNSXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWCHDNGVNYKIGEKWD
RQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQ
RGWRCDNCRRPGAEPEGSTGHSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADRDDSRE
Download sequence
Identical sequences ENSMICP00000013331 ENSMICP00000013331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]