SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013499 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013499
Domain Number 1 Region: 28-262
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.74e-77
Family Ecto-ART 0.0000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013499   Gene: ENSMICG00000014815   Transcript: ENSMICT00000014806
Sequence length 295
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4393:59516:62110:1 gene:ENSMICG00000014815 transcript:ENSMICT00000014806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLAALLIALGCLGLHALWQAQAVPILPLGLAPDTFDDAYVGCSEEMEEKAASLLKEEMA
HHALLRESWEAAQEAWEHRRRGLTLPSGFKAQHGIAIMVYTNSSNTLYWELNHAVRTGGG
SREHYMRHFPFKALHFYLTRALQLLQGSGGCSRGPGEIVFRGVLSLRFEPRRLGDSVRFG
QFASSSLDEAMARRFGNATLFSLRTCFGAPIQALSVFPEEHEVLIPPHEVFSVIRFSQDG
AQNLVTLWSYNQTCSHFNCAFLGGEKRQGCVYTPAVLGTGDLLINIKKGGFKQPQ
Download sequence
Identical sequences ENSMICP00000013499 ENSMICP00000013499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]