SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013577 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013577
Domain Number 1 Region: 399-574,607-703
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 1.7e-58
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00038
Further Details:      
 
Domain Number 2 Region: 1121-1177
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 9.16e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 3 Region: 703-746
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000785
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013577   Gene: ENSMICG00000014891   Transcript: ENSMICT00000014891
Sequence length 1177
Comment pep:novel genescaffold:micMur1:GeneScaffold_3513:216927:332294:1 gene:ENSMICG00000014891 transcript:ENSMICT00000014891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSTNPGNWVTFDDDPAFQSSQKSKNLPLENQGVCRPNGLKLNLSGLKEFPSGSSSTSST
PLSSPIVDFYFSPGPPSNSPLSTPTKDFPGIPGIPKAGTHVLYPIPESSSNSPLTPPGVG
SSLPPTKPTCLSHAFLPSDHSCTGLPDEISPHQAESQGFQSGDAPQFQYFREDWAFSSPF
WKDEGSASQFTFEPPGGRKIFSSRDKEIPIDQKSLNKCSLNYICEKLEHLQSAENQDPLG
NLSMQCLCAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVSYTEKRKYHSKTEV
AHEPDIEQMLKLGSTEYHDFLDFLTTVEEELVKLPAISKPKKNYEEQEISLEIVDNFWGK
VTKEEGKLVESAVMTQIWCLCFLNGNMECFLTLNDLELQKRDACYFEKDSEKKGIDILDY
HFHKCVKAQEFEQSRIIKFVPLDACRFELMRFKTLYHGDDLPFSVKSIVVVQGAYVELQA
FVNMAPLAQRPSHTGSLRSCDNVMIHFPVPSQWIKALWTMNLQRQKSLKAKMNRRACLGS
FHEPESEPVIQVTVGSAKYESAYQAVVWKIDRLPDKNSSPDHPHCLSYKLELGSDQEIPS
DWYPFATVQFSMLDTCASRTAVGSLGVESDVQPQKHVQQRACYNVQPKLYRSVIEDVIEG
VRDLFAEEGIEEQVLKDLKQLWETKVLQSKATEDFFRNSVHPPLFTLQLPHSLHQTLQSS
TASLVIPAGRTLPSFTTAELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXDSNSQIDSNIQVTDDDINEIIQIDGTSDTSSSKEIGSRRDVDENEFLGIIDAGDL
KVLEEEADSISNEDSTANSSDNEDSQVDIVEEDPLNSGDDVSEQDVPDLFDTDNVIVCQY
DKIHRSKNKWKFYLKDGVMCFGGRDYVFAKAIGDAEW
Download sequence
Identical sequences ENSMICP00000013577 ENSMICP00000013577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]