SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013718 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013718
Domain Number 1 Region: 128-498
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.14e-137
Family alpha-mannosidase 0.00000000136
Further Details:      
 
Domain Number 2 Region: 647-727,757-1141
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.36e-84
Family alpha-mannosidase, C-terminal domain 0.00000629
Further Details:      
 
Domain Number 3 Region: 501-613
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 6.87e-30
Family alpha-mannosidase, domain 2 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013718   Gene: ENSMICG00000015033   Transcript: ENSMICT00000015045
Sequence length 1142
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1212:26502:203771:1 gene:ENSMICG00000015033 transcript:ENSMICT00000015045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPRSPREGSFPQXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXMLDVYSLLSFDNPDGGVWKQGFDIEYETNEWDTEPLQIFVVPHSHNDPGWL
KTFNDYFRDKTQYIFNNMVLKLGEDSRRKFIWAEISYLSKWWDIIDNQKKDAVKSLIENG
QFEIVTGGWVMPDEANPHYFALIDQLIEGHQWLENNLGVKPRSGWAIDPFGHSPTMTYLL
KRAGFSHMLIQRVHYAIKKHFALQKSLEFFWRQNWDLGSVTDILCHMMPFYSYDIPHTCG
PDPKICCQFDFKRLPGGRLGCPWGYPPQTIHAENVQSRASLLLDQYRKKSKLFRSKVLLA
PLGDDFRYCEYTEWDLQFKNYQRLFDYMNSHPHFNVMIQFGTLSDYFDALDKAAANQREK
SQSMFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIIESHLRAAEILYYLALRRAEK
YKINTFLSSSHYKSLIEARRNLGLFQHHDAIAGTAKDWVVVDYGTRLFHSLIVVEKIIGS
SAFLLILKDKHVYNSYSSDAFLDMXXXXXXXXXXXXXXXXXXXXXXXHLVIFNPLEQDRT
SVVSVYVNSPTVEVSSASGEPIKVQVSAVWDEKNVISETAYEVSFLAHVPPLGMKVYKIL
ESASSNSHLANYVLHNGKAEDTRIFNVKNNVLGRESITLENSFIAVWFGHSGLMQKMMTK
EDGKHHEVRVQFSWYGTTRKADKSGAYLFLPDGDAKPYVYKLPPLVRVTHGRIYSEVTCI
FEHVTHRVRLYHIEGIEGQSVEVSNIVDIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI
QPRMTMKKLPLQANVYPMTTMAYIQDAECRLTLLSAQSLGVSSLKSGQIEVIMDRRLMQD
DNRGLGQGVYDNKITANLFRILLEKRSAVNLEEEKHPVSYPSLLSHITSSFMNHPLITMT
KKFSRDLELLGEFSPLLSPLPCDIHLVNLRTIQSKVGDGYSDEAALILHRKGFDCRFTSK
DTGLLCPTTQGKMLVQKLFNKFTVESLTPSSLSLMHSPPDAQNISEITLSPMEISTFRIR
LR
Download sequence
Identical sequences ENSMICP00000013718 ENSMICP00000013718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]