SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013814 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013814
Domain Number 1 Region: 632-783
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.52e-30
Family Phosphate binding protein-like 0.00000512
Further Details:      
 
Domain Number 2 Region: 412-489
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000000000000119
Family Phosphate binding protein-like 0.0000909
Further Details:      
 
Domain Number 3 Region: 34-227
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000029
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000013814
Domain Number - Region: 351-390
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00318
Family L-arabinose binding protein-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013814   Gene: ENSMICG00000015136   Transcript: ENSMICT00000015145
Sequence length 836
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_967:195:53089:-1 gene:ENSMICG00000015136 transcript:ENSMICT00000015145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAK
ARVEVDIFELRDCQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKVG
PEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRGF
LISKTLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLILRKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVEYDGLTGRV
EFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVTTI
LENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGSWT
GMVGELINRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGG
FMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQT
NIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFLLE
STMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKRKW
WEGGRCPKEEDHRAKGLGMENIGGIFVVLICGLIIAVFVAVMEFIWSTRRSAESEE
Download sequence
Identical sequences ENSMICP00000013814 ENSMICP00000013814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]