SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014002 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000014002
Domain Number - Region: 79-113
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 0.0732
Family Hypothetical protein TM0269 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014002   Gene: ENSMICG00000015347   Transcript: ENSMICT00000015358
Sequence length 216
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3585:23523:34358:1 gene:ENSMICG00000015347 transcript:ENSMICT00000015358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PIYHTPTRTVPENGAGWPKGLTKVLLVFLSPLANNFSDRFSFYRHHVNLKSWWVGDIPVS
GALLTEWSQDTMRELHLAIPAEITREKLEQVARIVYQKMDQLYQGKMYFPGYFPNELRAI
FREQVHLIQNAIIESRIDCQRHCGIFQYETISCNNCTDSHVVCFGYNCESSEQWEAAVQG
LLSYISDWHNLVSPSFTCLEPHANLTLENASELTQH
Download sequence
Identical sequences ENSMICP00000014002 ENSMICP00000014002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]