SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014310 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014310
Domain Number 1 Region: 9-100,148-229
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000753
Family DNA gyrase/MutL, N-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000014310
Domain Number - Region: 710-763
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00602
Family RILP dimerisation region 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014310   Gene: ENSMICG00000015693   Transcript: ENSMICT00000015706
Sequence length 872
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1871:255535:301637:-1 gene:ENSMICG00000015693 transcript:ENSMICT00000015706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NAVDPDVVTVFIDVEEVKSKCLTFTDDGCGMTPHKLHRMLSFGFTDKEIRKSQCPIGVFG
NGFKSGSMRLGKDALVFTKNGGTLTVGLLSQTYLECVQAQAVIVPIVPFNQQNKKMIVTE
DSLPSLEAILNYSIFNSENDLLSQFDAIPGKKGTRVLIWNIRRNKDGKSELDFDTDQYDI
LVSDFDTEEKETGGITSELPETEYSLRAFCGILYMKPRMKIFLRQKKVTTQIIAKSLAXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTCGEGVGVIG
VIECNFLKPAYNKQDFEYTKEYRLTINAFQKLAYWKEKTFQENLKPSTIARPIPXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRCSVPEEQELIDEDLYLSKAKKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMAGLNYMTTGYEEIDSPNVLPAIREESRS
PLQLTPLDSSVFQFSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXNSHDKSSSERSTPPYLFPEYPEANKSTGQSRDVPVLYPGAQDQHQGSLLPEELEDQM
PRLVAEESNRGSTNINKEEVNKGPFVAIVGVAKGVKDSGAPIQLIPFNREDLAERRKAVE
SWNPGPYSSVASAAVPAAAIGEKGRGYEESGGRNTSKVENQRELEELKRTTEKLERVLAE
RNLLQQKVEELEQERNHWHSEFKKVQHELVTYSTQETEGLYWSKKHMGYRQAEFQILKAE
LERTKEEKQELKEKLKETETHLEMLQKAQVSYRTPEGDDLERALAQLTRLRIHVSYLLTS
VLPHLELREIGYDSEQVDGILYTVLEANHILD
Download sequence
Identical sequences ENSMICP00000014310 ENSMICP00000014310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]