SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014416 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014416
Domain Number 1 Region: 124-186
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 7.98e-21
Family VPS28 C-terminal domain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 18-64
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000000000271
Family VPS28 N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014416   Gene: ENSMICG00000015817   Transcript: ENSMICT00000015820
Sequence length 214
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3858:293517:297251:-1 gene:ENSMICG00000015817 transcript:ENSMICT00000015820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGMGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VTPNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDCPLAMRIKEDRPITIKDD
KGLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQ
WVSHLATSHVAPLRPFTPTPVVLSAADPEWHVSI
Download sequence
Identical sequences ENSMICP00000014416 ENSMICP00000014416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]