SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014545 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014545
Domain Number 1 Region: 363-770
Classification Level Classification E-value
Superfamily ALDH-like 7.33e-91
Family ALDH-like 0.000000134
Further Details:      
 
Domain Number 2 Region: 71-353
Classification Level Classification E-value
Superfamily Carbamate kinase-like 2.23e-50
Family PyrH-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014545   Gene: ENSMICG00000015958   Transcript: ENSMICT00000015956
Sequence length 795
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1026:336248:375120:-1 gene:ENSMICG00000015958 transcript:ENSMICT00000015956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSQVYHCGFQPFKQRLLPWVKCTAVSRSHCVQTSAIRHVRSWSNIPFITVPLSRAHGKS
FAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDAVVPPAEPNSDLQGVNV
ISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTK
SRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAG
PTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDMEEAEGRLAA
PLLKRLSLSTSKLNSLAIGLRQIASSSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIF
ESRPDCLPQVAALAIASGNGLLLKGGKEATHSNRILHLLTQEALSIHGVKEAVQLVNTRE
EVEDLCRLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRL
VRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSE
VKSLRTEYGDLELCIEVVDNVQEAIDHIHKYGSSHTDVIVTENEKTAEFFLQHVDSACVF
WNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGSL
KYLHENLPIPQRNVN
Download sequence
Identical sequences ENSMICP00000014545 XP_012622373.1.48125 XP_012622381.1.48125 XP_012622387.1.48125 XP_020136189.1.48125 ENSMICP00000014545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]