SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014549 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014549
Domain Number 1 Region: 824-1050
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.06e-64
Family Methionine synthase SAM-binding domain 0.00000461
Further Details:      
 
Domain Number 2 Region: 21-308
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 2.43e-63
Family Homocysteine S-methyltransferase 0.00035
Further Details:      
 
Domain Number 3 Region: 265-460
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 3.66e-61
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0011
Further Details:      
 
Domain Number 4 Region: 666-817
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 9.29e-44
Family Cobalamin (vitamin B12)-binding domain 0.00000281
Further Details:      
 
Domain Number 5 Region: 559-648
Classification Level Classification E-value
Superfamily Methionine synthase domain 9.81e-27
Family Methionine synthase domain 0.0000353
Further Details:      
 
Domain Number 6 Region: 1097-1160
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 3.92e-22
Family Methionine synthase SAM-binding domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014549   Gene: ENSMICG00000015938   Transcript: ENSMICT00000015960
Sequence length 1161
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1350:356755:471783:1 gene:ENSMICG00000015938 transcript:ENSMICT00000015960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPALKELSQPAGLKKTLRDDIEAILRKRIMVLDGGMGTMIQRHKLSEEHFQGQEFKDHA
RPLKGNNDILSITQPDIIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNKC
SAGVARKAAEEITLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYEEQA
KGLLDGGVDILLIETIFDTANAKNFAMDGLVNIVGGCCGSTPDHIXXXXXXXXXXXXXXX
XXXXXXXXXXXXXLESFKIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALGIAKAQV
EMGAQVLDVNMDDGMLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGK
CIVNSISLKEGEEDFLEKARKIKKFGAAVVVMAFDEEGQATETDTKISICTRAYHLLVKK
LGFNPNDIIFDPNILTIGTGMEEHNLYAINYIHATKVIKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXTHGKGGKKVIQTDEWRSSPVEERLEYALVKGIEKHIVEDTEEARLNQEKYPRPLN
IIEGPLMNGMKIVGELFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETRVLNGTVE
EEASDPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILQAAIDHKA
DIIGLSGLITPSLDEMIFVAKEMERLAIKIPLLIGGATTSRTHTAVKIAPRYSAPVIHVL
DASKSVVVCSQLLDENLKDEYFEEIMEEYEDIRQDHYESLKERRYLPLSQARKNGFHIDW
LSEPQPVKPTFIGTQVFEDYDLQKLVGYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGE
EAKKVYDDAQNMLNTLISQKKLQARGVVGFWPGQSVQDDIHLYAEGAPPPAAQPIATFYG
LRQQAEKDSASTEPYHCLSDFVAPLHSGVRDYLGLFAVACFGVEELSKAYEDDSDDYSSI
MVKALGDRLAEAFAEELHERVRRELWAYRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXIRLTESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQIEDYASR
KNMSVAEVEKWLGPILGYDTD
Download sequence
Identical sequences ENSMICP00000014549 ENSMICP00000014549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]