SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014626 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014626
Domain Number 1 Region: 233-336
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.01e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00058
Further Details:      
 
Domain Number 2 Region: 2-67
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000014626
Domain Number - Region: 82-128
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00017
Family BphP N-terminal domain-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014626   Gene: ENSMICG00000016027   Transcript: ENSMICT00000016044
Sequence length 798
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3493:360630:424126:1 gene:ENSMICG00000016027 transcript:ENSMICT00000016044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHNEVSAQTEICDI
QQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHLPXXXXDQNLLS
FPEQEHSEVKMLLHMLVSDPSPEYLKSDNDLEFYCHLLRGSLNPKEFPTYEYIKFVGNFR
CYNNVPSPSCNGFDSTLSRPCRVPPGKEVCFIATVRLATPQFLKEMCIVDEPLEEFTSRH
SLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCHQHLMQFGKGKSCCYR
FLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVERRQELALEDPPSEAIH
PSALKDKGSGLEPQQHFNPLDVGTSVNASHSPSASSRSSHKSSHTAPSEPTSTPTKLMAE
ASTPALPRSATLPQELPMPGLSQAATMPAPLPSPSTCDLTQQLLPQTILQSPPAPMAQFS
AQFSMFQTIRDQLEQRTRVLQASIRWQQEELHKIQEQLCLVQDSNVQMFLQQPAVSLSFS
STQRPEAQQQLQQRSAAVTHPPLGAGPQLPGQITSAQVTSQHLLRESSVISTQGPKPMRS
SQVLQGGGRSVSSLASQFSSAAAVLPPSLNLTTPASTSQDANQCQPSPDFSHDRQLRLLL
SQPIQPMMPGSCDGRQPSEVSRTGRQVKYAQSQTVFQTPDVHPASSSSSAPTPILLTGQA
VLHPSFPASQPPAQHYLQVQAPTSLHSEQQDSLLLSTFSQQPGTLGYPPPPPAPPQAPRP
PRRVSSLSESSGLQQPPR
Download sequence
Identical sequences ENSMICP00000014626 ENSMICP00000014626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]