SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014635 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014635
Domain Number 1 Region: 292-552
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.45e-76
Family Eukaryotic proteases 0.0000692
Further Details:      
 
Domain Number 2 Region: 173-279
Classification Level Classification E-value
Superfamily Kringle-like 1.18e-30
Family Kringle modules 0.00021
Further Details:      
 
Domain Number 3 Region: 73-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000175
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 4 Region: 112-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000152
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014635   Gene: ENSMICG00000016037   Transcript: ENSMICT00000016053
Sequence length 556
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2532:313723:346334:1 gene:ENSMICG00000016037 transcript:ENSMICT00000016053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAGMSGLHVLLLMVLVGKPAFGSFLTSIFEHLSTDWAGGSHDVHSYEYYDEEEHLSTQP
THPDNPDWYYEEDDACQPNPCKHGGDCLTDGGTFTCSCLDPFSGSRCQNVQNNCKNNPCG
RGHCLITQSPPYYRCACKHPYTGSRCSIVTPVCRPNPCRNGGTCSRNKRRSRFSCSCPAH
FRGRLCEIGPDDCYVGDGSSYRGQVSRTVTQRTCLHWNSPLLLQENYNVFMENAEAQGIG
EHNFCRNPDGDQKPWCYIKVNSEKVEWEYCEVFACSAQDIACPEESPTEPLARPLMFESC
GRTETAERHIKRIYGGFKSTAGKHPWQVSVQTASRTRGHFCGGSLIHPCWVLTAAHCTEE
KARYLTVVLGKQDLKKTEFHEQSFGVEKIFKHYNYHETDEIPHNDIGKTLLKLKPVDGHC
ALESKYVKTVCLPDGPFPSGTECHISGWGVTETGEESRQLLDAKVKLITNGLCNSRRLYN
HLIDDSMICAGNLQKPGRDTCQGDSGGPLTCEKDGTYFVYGIVSWGLGCGEKPGVYTQVT
KFLDWIKATIQKETGF
Download sequence
Identical sequences ENSMICP00000014635 ENSMICP00000014635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]