SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014711 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014711
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.35e-30
Family N-terminal domain of MutM-like DNA repair proteins 0.000000315
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.91e-27
Family Middle domain of MutM-like DNA repair proteins 0.0000023
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.71e-19
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.000093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014711   Gene: ENSMICG00000016138   Transcript: ENSMICT00000016140
Sequence length 386
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2208:1623:6972:1 gene:ENSMICG00000016138 transcript:ENSMICT00000016140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASHFVNEACRGLVFGGCVEKSSISRNPEVPFESSAYCISASARGKELRLSL
SPLPGAQPPQEPLALVFRFGMSGSFQLVPGDALPPHAHLRFYTAPPGPRLALCFVDIRRF
GHWDIGGKWQPGRGPCVLLEYEQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA
EILFRLRIPPFEKARTVLEALQRRRLSPELTLSQKIKAKLQNPDLLELCHSVPKEVVQLG
GKGYGPESGEEDFAAFRAWLRCYGVPGMSSLRDRHGRTIWFQGDPGPLAPKGRKSRKKKS
KATRLSPEDRVENLPPPNKAPSRTRRAWRDLPEKTATQQPQGTIVHQDPEVPTVPRKGRQ
ATPGHCSPWKIKADAPSLELEGTSAS
Download sequence
Identical sequences ENSMICP00000014711 ENSMICP00000014711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]