SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014727 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014727
Domain Number 1 Region: 542-960
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.08e-90
Family alpha-mannosidase, C-terminal domain 0.046
Further Details:      
 
Domain Number 2 Region: 188-437
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.73e-48
Family 4-alpha-glucanotransferase, N-terminal domain 0.044
Further Details:      
 
Domain Number 3 Region: 438-539
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 2.75e-25
Family alpha-mannosidase, domain 2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014727   Gene: ENSMICG00000016151   Transcript: ENSMICT00000016161
Sequence length 964
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2208:8103:18816:-1 gene:ENSMICG00000016151 transcript:ENSMICT00000016161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WWTCWFRVELTIPEAWVGQEVHLCWESDGEGLVWRDGEPVQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXWLWPFKETIRKCARSWVTAVQLMEQNPKFIFACSQAQQLEWVRNHYPGLHAR
LQEFACRGQFVPVGGTWVEMDGNLPGGEAMVRQFLQGQNFFLQEFGKMCSEWLPNKSYST
QLXXXXXXXXXXXXXXXXXXXXXXXSFPHHTFFWEGLDGSHVLVHFPPGDSYGMQGSVDE
VLKTVANNRDKGRTNHSAFLFGFGDGGGGPTQTMLDRLTRLGNTDGLPRVQLSSPKQLFS
ALESDSGQLCTWVGELFLELHNGTYTTHAQIKKGNRECERILHDVELLSSLALARSAQFL
YPAARLQHLWRLLLLNQFHDVVTGSCIQLVAEDAMCHYADIRSHGNTLLSTAAAALCAGE
PGPEGLLVVNTLPWKRTEVLALPKPGGAHSLALVTVPSMGYAPVPAPTSLQPLLPQQPVF
VVQETDGSVTLDNGIIRVRLDPTGRLTSLVLVASGREAIAEGAVGNQFVLFDDVPLYWDA
WDVMDYHLETRKPVLGQAGTLAVGTEGGLRGSAWFLLQITPNSRLSQEVVLDVGCPYVRF
HTEVHWHEAHKFLKVEFPARVRCSQATYEVQFGHLQRPTHYNTSWDWARFEVWAHRWMDL
SEHGFGLALNDCKYGASVRGSVLSLSLLRAPKAPDATADMGRHEFTYALMPHKGSFQDAG
VIRAAYSLNFPLLALPVPGPAPATSWSAFSLSSPAVVLETVKQARGGAPESQSRALVLRL
YEAHGSHVDCWLHTSLPIQEAILCDLLERRNPAGHVPLQDNRLKLTFSPFQVQSLLLVLQ
PPPN
Download sequence
Identical sequences ENSMICP00000014727 ENSMICP00000014727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]