SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014744 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014744
Domain Number 1 Region: 21-361
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 4.32e-70
Family ADP-ribosylglycohydrolase 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014744   Gene: ENSMICG00000016186   Transcript: ENSMICT00000016177
Sequence length 365
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_654:139251:144638:1 gene:ENSMICG00000016186 transcript:ENSMICT00000016177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAAMTAAGGGGAGAARSLSRFRGCLAGALLGDCVGAIYEAHDTVDLTSVLRHVQSLE
PDPGTPGSARTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAG
VITVFKKLLNPKCRDVYEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQ
LTHASSLGYNGAILQALAVHLALQGESSSEHFLEQLLGHMEELEGDAQSVLDARELGMEE
RPYSSRLKKIGELLDQDSVSREDVVSELGNGIAAFESVPTAIYCFLRCMEPDPEIPSAFN
SLQRTLIYSISLGGDTDTIATMAGAIAGAYYGMDQVPESWQQSCEGYEETDVLAQSLHRV
FQKSL
Download sequence
Identical sequences XP_012620684.1.48125 ENSMICP00000014744 ENSMICP00000014744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]