SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014789 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014789
Domain Number 1 Region: 170-351
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.31e-30
Family ADP-ribosylglycohydrolase 0.0089
Further Details:      
 
Domain Number 2 Region: 1-116
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.09e-17
Family ADP-ribosylglycohydrolase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014789   Gene: ENSMICG00000016236   Transcript: ENSMICT00000016226
Sequence length 354
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2698:3393:16527:-1 gene:ENSMICG00000016236 transcript:ENSMICT00000016226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERFQAAMLLGGVGDALGYRNLCAENSAVAGSEVQEELRRGGGLEQLVLSPGKWPVSDNTV
MHIATAQALTTDYWCLDDLYREMVRRYVDVVEKLPERRPDPATVEGCSQLKPDNYLLAWH
TPFNEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLGSLCTALFV
SYAIQGRPLAQWGRDMLRVVPLAEEYCRRTIRHMAEYQEHWFYFEAKWQFYLEERKISED
QENKATFPDNYDAEERDKAYRKWSSEGRGGRRGHDAPMIAYDALLAAGSSWAELCRRAMF
HAGESAATGAIAGCLFGLLYGLDAVPSGLYRELQHRETLEALGAALHRLSTEEK
Download sequence
Identical sequences ENSMICP00000014789 ENSMICP00000014789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]