SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014793 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014793
Domain Number 1 Region: 22-246
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.71e-74
Family Carbonic anhydrase 0.00000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014793   Gene: ENSMICG00000016228   Transcript: ENSMICT00000016230
Sequence length 310
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1808:17787:39843:1 gene:ENSMICG00000016228 transcript:ENSMICT00000016230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALVPLLSLFLLGTQAQHGTEWTYSDGALDEAHWPRQYPDCGGQKQSPINLQRKNVRYN
PSLGALNLTGYGAQVGKFSMTNNGHTVQITLPPTMQVTTMDGTRYIAQQMHFHWGGASSE
MSGSEHTIDGVRHVVEIHVVHYNSKYRNYDIAKDAPDGLAVLACFVEVNDYAENTYYSNF
ISHLANIKYAGQSTILRGLDVKDMLPANLRQYYSYQGSLTTPPCTENVHWFVLADTVKLS
KAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGHEHANPGPRIQPSSTR
HPLDSGSSAQ
Download sequence
Identical sequences ENSMICP00000014793 ENSMICP00000014793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]