SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000014940 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000014940
Domain Number 1 Region: 30-290
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.83e-80
Family Carbonic anhydrase 0.00000701
Further Details:      
 
Domain Number 2 Region: 794-970,1018-1087
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-67
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000957
Further Details:      
 
Domain Number 3 Region: 1091-1318
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.83e-46
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000014940
Domain Number - Region: 378-413
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00832
Family Fibronectin type III 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000014940   Gene: ENSMICG00000016378   Transcript: ENSMICT00000016391
Sequence length 1412
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2380:173508:714587:1 gene:ENSMICG00000016378 transcript:ENSMICT00000016391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTEGYTGALHENRHGSSVQIRRRKASGDPYWAYSGAYGPEHWVTSSVSCGGRHQSPIDIL
DQHARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKDDYFVSGAGLPGRFKAEKVE
FHWGHSNGSAGSEHSINGRRFPVEMQIFFYNPDDFDSFQTAISENRIIGAMAIFFQVSPR
DNSALDPIIHGLKGVVHHEKETFLDPFVLRDLLPASLGSYYRYTGSLTTPPCSEIVEWIV
FRRPVPISYHQLEAFYSIFTTEQQDHVKSVEYLRNNFRPQQDLNNRVVSKSAVRDAWNHD
MTDFLENPLGTEASKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXKATISHVSPDSLYLFRVQAVCRNDMRSDFSQTMLFQANTTRIF
GTRIVKGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXTDWPGGRRDAGPGLGPGSVTSTQVPATATEEQFTAGDPR
RPEAPSKKPASRGDRFSEDSRFITVNPXXXXXXXXXXXXAPGRMEWIIPLIVSATFVCLV
LLIAVLVYWRGCNKIKSKGFPRRFREVPSSGETGEKGSRKCFQTAHFYVEDSNSPRVVPN
ESIPIIPIPDDMEAIPVKQFVKHIGELYSNNQHGFSEDFEEVQRCTADMNITAEHSNHPE
NKHKNRYINILAXXXXXXXXXXXXXXXXXXXXXXXXXXXXGYNKAKAYIATQGPLKSTFE
DFWRMIWEQNAGVIIMITNLVEKGRRKCDQYWPTENSEEYGNIIVTLKSTKVHACYTVRR
FSVRNTKVKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSSAARTPDM
GPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNILGFLKHIRTQRNYLVQTEEQYIFIH
DALLEAILGKETEVSSNQLHSYVNSILIPGVGGKTRLEKQFKXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXERARVGLAPLPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKD
FWRMIWDHNAQIIVMLPDNQSLAEDEFVYWPSREESMNCEAFTVTLISKDRLCLSNEEQI
IIHDFILEATQDDYVLEVRHFQCPKWPNPDAPISSTFELINVIKEEALTRDGPTIVHDXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQYQFVYKAMLSLVST
KENGNGPMTVDRNGAVLIADESDPAESMESLV
Download sequence
Identical sequences ENSMICP00000014940 ENSMICP00000014940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]