SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015002 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015002
Domain Number 1 Region: 31-413
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.92e-67
Family L-arabinose binding protein-like 0.0047
Further Details:      
 
Domain Number 2 Region: 509-545,664-803
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.45e-39
Family Phosphate binding protein-like 0.000000166
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000015002
Domain Number - Region: 567-659
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00122
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015002   Gene: ENSMICG00000016437   Transcript: ENSMICT00000016460
Sequence length 905
Comment pep:known_by_projection scaffold:micMur1:scaffold_575:118617:337869:1 gene:ENSMICG00000016437 transcript:ENSMICT00000016460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAPWRRLRSLVWEYWAGLLVCAFWIPDSRGMPHVIRIGGIFEYADGPNAQVMNAEEHAF
RFSANIINRNRTLLPNTTLTYDIQRIHFHDSFEATKKACDQLALGVVAIFGPSQGSCTNA
VQSICNALEVPHIQLRWKHHPLDNKDTFYVNLYPDYASLSHAILDLVQYLKWRSATVVYD
DSTGLIRLQELIMAPSRYNIRLKIRQLPIDSDDSRPLLKEMKRGREFRIIFDCSHTMAAQ
ILKQAMAMGMMTEYYHFIFTTLDLYALDLEPYRYSGVNLTGFRILNVDNPHVSAIVEKWS
MERLQAAPRAESGLLDGVMMTDAALLYDAVHIVSVCYQRAPQMTVNSLQCHRHKAWRFGG
RFMNFIKEAQWEGLTGRIVFNKTSGLRTDFDLDIVSLKEDGLEKVGVWSPADGLITEAKG
RGPNVTDSLTNRSLIVTTVLEEAFVMFRKSDRTLYGNDRIDGYXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXKADLAVAPLTITHVREKAIDFSKPFMTLGVSI
LYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSE
VVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFMSSKPSALVKNN
EEGIQRTLTADYALLMESTTIEYVTQRNCNLTQIGGLIDSKGYGIGTPMGSPYRDKITIA
ILQLQEEDKLHIMKEKWWRGSGCPEEENKEASALGIQKIGGIFIVLAAGLVLSVLVAVGE
FVYKLRKTAEREQRVCSVDEIRSPHCRVHKQPMMVKTDVINMHTFNDRLPGDSMACSTSL
APVFP
Download sequence
Identical sequences ENSMICP00000015002 ENSMICP00000015002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]