SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015156 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015156
Domain Number 1 Region: 523-693
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.53e-57
Family PDEase 0.0000464
Further Details:      
 
Domain Number 2 Region: 162-263
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.54e-18
Family Flavin-binding PAS domain 0.05
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000015156
Domain Number - Region: 36-109
Classification Level Classification E-value
Superfamily CheY-like 0.000757
Family CheY-related 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015156   Gene: ENSMICG00000016635   Transcript: ENSMICT00000016633
Sequence length 693
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1218:127564:289687:1 gene:ENSMICG00000016635 transcript:ENSMICT00000016633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVSSAEVRIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFL
DKHHEIIVIDHRQSRNFDAEAVCRSIRATNPSEHTVILAVVSQASDDHEEASVLPLLHAG
FNRRFMENSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQY
VNPAFERMMGYHKGELLGKELADLPKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGD
SIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDNNKQIHKVHRDSGDNSQTEPHSFRYKNR
RKESIDVKSISSRSSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAE
ALDRVLEILRTTELYSPQLGTKEEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSH
LAMPITINDVPPCVAQLLDNEESWDFNIFELEAVTHKRPLVXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSLDQLDEVAALIAAT
VHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHY
RTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPLAAEIEGSDCECNPIGKNFPENQILIK
RMMIKCADVANPCRPLDLCIEWAGRISEEYFAQ
Download sequence
Identical sequences ENSMICP00000015156 ENSMICP00000015156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]