SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015258 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015258
Domain Number 1 Region: 3-44,77-219
Classification Level Classification E-value
Superfamily Thiolase-like 1.06e-35
Family Thiolase-related 0.017
Further Details:      
 
Domain Number 2 Region: 543-617,680-777
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.66e-30
Family FabD-like 0.0071
Further Details:      
 
Domain Number 3 Region: 1268-1397
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000000000000118
Family UbiE/COQ5-like 0.032
Further Details:      
 
Domain Number 4 Region: 1697-1798
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000000000000837
Family Alcohol dehydrogenase-like, C-terminal domain 0.0019
Further Details:      
 
Domain Number 5 Region: 1881-1970
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000000277
Family Tyrosine-dependent oxidoreductases 0.0056
Further Details:      
 
Domain Number 6 Region: 617-673
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000112
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015258   Gene: ENSMICG00000016735   Transcript: ENSMICT00000016744
Sequence length 1971
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3450:25:13899:-1 gene:ENSMICG00000016735 transcript:ENSMICT00000016744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAMKEVVIAGMSGKLPESENLEEFWANLIGGVDMVTDDDRRWKAXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINPASLRGTHTGVWVGVGGSEASE
ALSRDPETLLGYSMVGCQRAMMANRLSFFFDFKGPSVSLDTACSSSLLALQNAFHAIRSG
ECPAAIVGGINLLLKPNTSVQFMKLGMLPEGTCKSFDDAXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
STEENFDDIVHAFVSLTAIQIALLDLLSSMGLRPDGIIGHSLGEVACGYADGCLSQEEAV
LAAYWRGQCIKEANLPPGSMAAVGLSWEECKQRCPPGVVPACHNSEDTVTISGPQAAVSA
FVEQLKQEGVFAKEVRTGGMAFHSYFMEAIAPTLLKALKKVIREPRPRSARWLSTSIPEA
QWRGSLARTSSAEYNVNNLVSPVLFQEALRHVPEHAVVLEIAPHALLQAVLKRGLKPSCT
IVPLMKKDHRDNLELFLAGVGKVHLAGIDVNPNALFPPVEFPPPRGTPLISPHIKWDHGQ
TWDVPAAEDFPNGSGSSSATVYNIDASPESPDHYLVDHCIDGRVIFPATGYLHLVWKTLA
RSLGLAMEQMPVVFEDVTIHQATILPKTGTVPLEVRLMEASRAFEVSENGNLIVSGKVYQ
WEDPDPTFFDHPEDPTPADPGALRLTQADAYKALRLRGYDYGPHFQGILDAXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLAGHGHLYSRIPGLL
NPQPMLQLSYTATDRHPQALEAAQAKLQQFDAAQAQWDPAEPAPSSLGSADLLVCNCAVA
GLGDPALALGHMAAALREGGFLLLHTLLRGHPLGDTMAFLSSSEPQLAQGLLSQDEWESL
FARTPLHLVGLKKSFYGSLFLCRRQATQDSPIFLPVEDTSFRWDSLKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXPSPGPRAPDPTGSAEKRAYLQARFPQLDSTSFANSRDTSFEQHVLRHTGGRGLD
LVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHPLGMAIFLKNVTFHGILLDALFEE
ASDDWREVLALLRAGIRDGVVQPLKCTVFPKARVEDAFRHMAQGKHIGKVVIQVRPEEPE
AAPKRVEPTVMAAIAKTFCPAHKSYVIAGGLGGFGLELAQWLVLRGAQRLVLTSRSGIRT
GYQAKQVREWRRQGVQVLVSASNASSPEGARALIAEATQLGPVGGVFNLAM
Download sequence
Identical sequences ENSMICP00000015258 ENSMICP00000015258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]