SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015456 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015456
Domain Number 1 Region: 27-136
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-43
Family FKBP immunophilin/proline isomerase 0.0000625
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015456   Gene: ENSMICG00000016960   Transcript: ENSMICT00000016959
Sequence length 139
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3375:369025:370484:1 gene:ENSMICG00000016960 transcript:ENSMICT00000016959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSWDRVLTVLSILSALTAGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDG
TEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPG
GATLVFEVELLKIERRSEL
Download sequence
Identical sequences ENSMICP00000015456 ENSMICP00000015456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]