SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015648 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015648
Domain Number 1 Region: 490-602
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.000000000785
Family Glycosyl transferases group 1 0.021
Further Details:      
 
Domain Number 2 Region: 40-199,234-348
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.0000000942
Family Glycosyl transferases group 1 0.032
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000015648
Domain Number - Region: 440-493
Classification Level Classification E-value
Superfamily DNA-glycosylase 0.016
Family Endonuclease III 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015648   Gene: ENSMICG00000017175   Transcript: ENSMICT00000017178
Sequence length 700
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1492:21817:97140:-1 gene:ENSMICG00000017175 transcript:ENSMICT00000017178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGRSLSVTSLSGLPQWEVEELPVENLLLFEVAWEVTNKVGGIYTVIQTKARTTADEWG
DNYFLIGPYFEHNMKTQVEQCEPANDAVKRAVETMNKHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEACGVGIPYHDREANDMLIFGSLTAWFLKEVTDHTDGRHVVTQFH
EQAGTGLILSRARLPIAXXXXXXXXXXXXXXXXXXXXXXXXXXXFNIDKEAGDRQIYHRY
CMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMYKA
RIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRVHKSDVTV
VVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYDALLRGEIPDMNNILDR
DDLTIMKRAIFSTQRQSLPPVTTHNMMDDSTDPILSTIRRIGLFNNRADRVKVIHPEFLS
STSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHVA
DPTAYGIYIVDRRFRSPDDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYLGR
YYQHARHLALSRAFPDKFHVEPRSPPTTEGFKYPRPSSVPPSPSGSQDSSPQSSDVEDET
DDERYDEEEEAERDRLNIKSPFSLSHVPRGKKKLHGEYKN
Download sequence
Identical sequences ENSMICP00000015648 ENSMICP00000015648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]