SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015723 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015723
Domain Number 1 Region: 3-212
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.61e-43
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015723   Gene: ENSMICG00000017262   Transcript: ENSMICT00000017261
Sequence length 343
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3290:886:22066:1 gene:ENSMICG00000017262 transcript:ENSMICT00000017261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAVSGSLVHDFKPKPQAPVLECSVSADSRRIVAASYDKFLRAWDLETGKPLWQTDYDSFI
ISCKLSPDGKYVALGLDMARAICIMDARTASTISLIKDHHRKSITACCFDPDSQRVASVS
LDKCIKIWDVTSQATLLTITNAHGNAISNCCFTFSGHFLCTSSWDKSLKIWNVHTGEFRN
QGACATLMQGHEGSVSCCCFARDSSFLVGGLDKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCVGCDRPFSIFEGDTS
SEIFNECVFCRREAKDLPDESSSSSSEQENSSPMPPPTGSTDD
Download sequence
Identical sequences ENSMICP00000015723 ENSMICP00000015723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]