SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015787 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015787
Domain Number 1 Region: 481-667
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-42
Family cAMP-binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 189-291,323-377,416-478
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-41
Family Voltage-gated potassium channels 0.0023
Further Details:      
 
Domain Number 3 Region: 12-108
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-19
Family Flavin-binding PAS domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015787   Gene: ENSMICG00000017331   Transcript: ENSMICT00000017331
Sequence length 960
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4584:438775:727383:-1 gene:ENSMICG00000017331 transcript:ENSMICT00000017331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTIEKVRQTF
ENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDDSCKG
WGKFARLTRALTSSRGVLQQLAPSVQKGENVHKHSRLAEVLQLGSDILPQYKQEAPKTPP
HIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTRQNNVAWLVVDSIVDVIFLVDIVL
NFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFENVDEVSAFMGDPGK
IGFADQIPPPLEGRESQGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFG
LAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLAMDIGTPYQFNGSGSGKWEGGPSKN
SVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIGSLLYATIFGNVTTIFQQMYA
NTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTEKVLQICPKDMRADI
CVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLE
VIQDDEVVAILGKGDVFGDVFWKEATLAQSCANVRALTYCDLHVIKRDALQKVLEFYTAF
SHSFSRNLILTYNLRKRIVFRKISDVKREEEERMKRKNEAPLILPPDHPVRRLFQRFRQQ
KEARLAAERGGRDLDDLDVEKGNVLTEHASANHSLVKASVVTVRESPATPVSFQAATSAG
VPDHAKLHAPGSECLGPKGGDCAKRKGWARFRDACGKGEDWNKVSKAESMETLPERTKAA
GEATLKKTDSCDSGITKSDLRLDNAGEARSPQDRSPILAEVKHSFYPIPEQTLQATVLEV
RHELKEDIKALNAKMTSIEKQLAEILRILTSRRSSQSPQELFEISRPQSPESERDIFGAS
Download sequence
Identical sequences ENSMICP00000015787 ENSMICP00000015787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]