SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015968 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015968
Domain Number 1 Region: 43-111
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.000000000034
Family Ribosomal protein L11, C-terminal domain 0.0089
Further Details:      
 
Domain Number 2 Region: 2-54
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.0000000019
Family Ribosomal L11/L12e N-terminal domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015968   Gene: ENSMICG00000017533   Transcript: ENSMICT00000017533
Sequence length 137
Comment pep:novel scaffold:micMur1:scaffold_35522:3947:4452:1 gene:ENSMICG00000017533 transcript:ENSMICT00000017533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILPKFDPNEIKVVYLRCTGSKVGATSVLAPNIGPLQAQIEVVPSVSALIFKALKEPLRDQ
KKQKNIKHNRNTTFDEIVNIARQMQHQSLARELSGTIQETLRTAQSVGCNGDGCHHDIID
DIIDGINSGAVECLPSK
Download sequence
Identical sequences ENSMICP00000015968 ENSMICP00000015968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]