SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015978 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015978
Domain Number 1 Region: 32-144
Classification Level Classification E-value
Superfamily FKBP-like 2.16e-32
Family FKBP immunophilin/proline isomerase 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015978   Gene: ENSMICG00000017544   Transcript: ENSMICT00000017544
Sequence length 198
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3360:92969:95965:-1 gene:ENSMICG00000017544 transcript:ENSMICT00000017544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRSLLPLLLLLLLLSGAMCRAEAGVETEPVRTLQVETLVEPPEPCAEPAAFGDTLHIH
YTGSLVDERIIDTSLSREPLVIVVGKTQLMTGLEQSLLDMCVGEKRRAIIPSHLAYGKRG
FPPSIPADAVVQYDVELIALIRANYWQKLVKSILPLVGMAMVPALLGLIGYHLYKKANRP
KVSKKKLKEEKRNKSKKK
Download sequence
Identical sequences ENSMICP00000015978 ENSMICP00000015978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]