SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000016147 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000016147
Domain Number 1 Region: 267-468
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-49
Family Voltage-gated potassium channels 0.00098
Further Details:      
 
Domain Number 2 Region: 7-39,89-159
Classification Level Classification E-value
Superfamily POZ domain 4.89e-28
Family Tetramerization domain of potassium channels 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000016147   Gene: ENSMICG00000017734   Transcript: ENSMICT00000017734
Sequence length 630
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3270:39309:221772:-1 gene:ENSMICG00000017734 transcript:ENSMICT00000017734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLAASEPQGDCLTAVGDKLQQSPPP
LSPPPRAPPLSPGPGGCFEGGAGNCSSHGGGGEHPGGGREFFFDRHPGVFAYVLNYYRTG
KLHCPADVCGPLFEEELAFWGIDETDVEPCCWMNYRQRDAEEALDIFEDPELIGGPGDDE
DAARLGIEDAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARXXXXXXXXXXXXXXXXX
XXXXXXXXXXXRLKNKTEPVVNGTSVQYENKTDPLTYVEGVCVVWFTFEFLVRIVFPNKL
EFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGL
RVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGF
WWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQK
LPRKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYEKSRSLNNIAGLA
GNALRLSPVTSPYNSPCPLRRSRSPIPSIL
Download sequence
Identical sequences ENSMICP00000016147 ENSMICP00000016147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]