SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000016255 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000016255
Domain Number 1 Region: 79-142
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.000000000000262
Family Ribosomal protein L11, C-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000016255   Gene: ENSMICG00000017849   Transcript: ENSMICT00000017849
Sequence length 160
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4618:152870:153640:1 gene:ENSMICG00000017849 transcript:ENSMICT00000017849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPPKFASNEIKVVLRGSCEVGATSARPPKRGTXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXSALIIKARPRDRKKQKIEHNGNITFDEIFNIARQMQHRSLTRELS
GTIKEILGTAQSVGCNFDGCHPHDIIDDINSGAVECPASK
Download sequence
Identical sequences ENSMICP00000016255 ENSMICP00000016255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]