SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005314 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005314
Domain Number 1 Region: 5-262
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.58e-102
Family Carbonic anhydrase 0.0000000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005314   Gene: ENSMICG00000005822   Transcript: ENSMICT00000005823
Sequence length 264
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3305:405071:413343:1 gene:ENSMICG00000005822 transcript:ENSMICT00000005823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGHHGWGYGQDDGPSNWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLEISYEACMSLS
ITNNGHSVQVDFNDCDDRTVVTGGPLEGPYRLKQFHFHWGKKHDAGSEHTVDGKSFPSEL
HLVHWNAKKYSTFGEAASAPDGLAVVGIFLETGDEHPSMNRLTDALYMVRFKGTKAQFSC
FNPKCLLPASRHYWTYPGSLTTPPLSESVTWIVLREPIRVSERQMEKFRSLLITSEDDER
IHMVNNFRPPQPLKGRVVKASFRA
Download sequence
Identical sequences ENSMICP00000005314 XP_012597927.1.48125 ENSMICP00000005314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]