SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005668 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005668
Domain Number 1 Region: 81-554
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.27e-133
Family Pyridoxal-dependent decarboxylase 0.0000967
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005668   Gene: ENSMICG00000006215   Transcript: ENSMICT00000006216
Sequence length 555
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4803:435703:501349:1 gene:ENSMICG00000006215 transcript:ENSMICT00000006216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRCQMDQETSGNGNKCALLYGDAERPAESGGNGPPRAAPRKAACACSQKPCSCPKADANY
AFLHATDLLPACDGERPTLAFLQEVMDILLQYVVKSFDRSTKVIDFHYPNELLQEYNWEL
ADQPQNLEEILMHCQTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEI
APVFVLLEYVTLKKMREIVGWPGGSGDGIFSPGGAISNMYAMMIARFKMFPEVKEKGMAA
VPRLIAFTSEHSHFLKKGAAALGIGTDSVILIKCDERGKMIPSDLERRILEAKQKGFVPF
LVSATAGTTVYGAFDPLLAIADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSV
TWNPHKMMGVPLQCSALLVREEGLMQNCNQMHASYLFQQDKHYDLSYDTGDKALQCGRHV
DVFKLWLMWRAKGTTGFEVHVDKCLELAEYLYNIIKNREGYEMVFDGKPQHTNVCFWYVP
PSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQD
IDFLIEEIERLGQDL
Download sequence
Identical sequences ENSMICP00000005668 ENSMICP00000005668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]